HORDB

ID: hor006418
Uniprot ID: P29007
Protein name: Gastrin-releasing peptide
Gene name: grp
Organism: Bombina orientalis (Oriental fire-bellied toad)
Family: Bombesin/neuromedin-B/ranatensin family
Source: animal
Expression: Brain and stomach. In the stomach GRP was localized, at the base of the gastric pits, to occasional cells whose distribution and appearance were consistent with that of gut neuroendocrine cells.
Disease: NA
Comments: NA
Taxonomy: Bombina (genus), Bombinatoridae (family), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: NA
GO BP: GO:0007218 neuropeptide signaling pathway; GO:0090277 positive regulation of peptide hormone secretion; GO:1900738 positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0031410 cytoplasmic vesicle; GO:0034774 secretory granule lumen

Sequence: SPTSQQHNDAASLSKIYPRGSHWAVGHLM
Length: 29
Propeptide: MEGVLLFWKYRALFFLVLCSLVLCKVHLSQASPTSQQHNDAASLSKIYPRGSHWAVGHLMGKKSIEEYPYAYDEADRSSAAVFSEGDKPSDGYQQWKESLLNLLKMIEVNEYRNSKAMREASVYNKKFSGAEDNNLKEMLDYLYQMMNMKENTSS
Signal peptide: MEGVLLFWKYRALFFLVLCSLVLCKVHLSQA
Modification: T29 Methionine amide
Glycosylation: NA
Mutagenesis: NA

Function: Stimulates the release of gastrin and other gastrointestinal hormones.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006418_AF2.pdb

hor006418_ESM.pdb

Mass:	367613	Formula:	C138H211N43O42S
Absent amino acids:	CEF	Common amino acids:	S
pI:	9.3	Basic residues:	5
Polar residues:	10	Hydrophobic residues:	8
Hydrophobicity:	-66.55	Boman Index:	-4981
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	60.69
Instability Index:	3295.17	Extinction Coefficient cystines:	6990
Absorbance 280nm:	249.64

PubMed ID: 1551901
Title: Gastrin-releasing peptide (GRP) is not mammalian bombesin. Identification and molecular cloning of a true amphibian GRP distinct from amphibian bombesin in Bombina orientalis.